PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000397.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 575aa    MW: 63591.5 Da    PI: 4.6019
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000397.1_g00016.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.61e-52181461128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              lp+G+rF+Ptdeelv++yLk k++g++ e+ +vi+evdi+k+ePwdLp +  v+++++ew+fF+++d+ky++g+r nrat++gyWk
  Itr_sc000397.1_g00016.1  18 LPVGYRFRPTDEELVDHYLKMKITGSEAEV-SVIREVDICKHEPWDLPdMsFVESHDNEWFFFCPKDRKYQNGQRLNRATERGYWK 102
                              799************************999.99**************96347788999**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              atgkd+++ s+kg++vg+kktLv+y grap+g++t Wv+heyr 
  Itr_sc000397.1_g00016.1 103 ATGKDRTISSRKGAKVGMKKTLVYYLGRAPEGKRTYWVIHEYRT 146
                              ******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-5814169IPR003441NAC domain
PROSITE profilePS5100555.318169IPR003441NAC domain
PfamPF023655.3E-2619145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 575 aa     Download sequence    Send to blast
MAVLKVERPT GLPPLHSLPV GYRFRPTDEE LVDHYLKMKI TGSEAEVSVI REVDICKHEP  60
WDLPDMSFVE SHDNEWFFFC PKDRKYQNGQ RLNRATERGY WKATGKDRTI SSRKGAKVGM  120
KKTLVYYLGR APEGKRTYWV IHEYRTTEKA FDGTHSGQAP FVLCRLFKKV ELKLDDGAEI  180
SNSGEVDPIV SSPTVVKTPT DDEQSEGGTP LMKSDHIKTQ PLTPGQSSVE EAPAVHFPID  240
SNSNSCIADI TEDQVLDITS NPADPDLEPW KFYFDPSAGP IFSPTYEQMP EFGSSYFYGD  300
VINCISNNND VQFQYGTNGF DPNEFLNPAA LVSSDGESEE VTQRLAEPVD FENELFVTNN  360
QEALLQRQVN YVANSLVGTF ATPTMGSDHQ NWNLDLQNNN YLGQSLFSSV STGTVAPQMV  420
FPQAETVGNI SSSGTGITLR TRQPQNQRGD QQSTAQGTAP RRIRFSTKFQ VGPVQCTRPQ  480
TTPEDNALSK EDASTVDKPN STASATAQDP ILEGRGEDNS EITTSEKEGD TSACRNETSV  540
KASSKTALCS SSSIYIPKGI LVNLAQMYLV SLELC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-431716916165NAC domain-containing protein 19
4dul_A1e-431716916165NAC domain-containing protein 19
1ut7_B1e-431716916165NO APICAL MERISTEM PROTEIN
1ut7_A1e-431716916165NO APICAL MERISTEM PROTEIN
1ut4_B1e-431716916165NO APICAL MERISTEM PROTEIN
1ut4_A1e-431716916165NO APICAL MERISTEM PROTEIN
3swp_D1e-431716919168NAC domain-containing protein 19
3swp_C1e-431716919168NAC domain-containing protein 19
3swp_B1e-431716919168NAC domain-containing protein 19
3swp_A1e-431716919168NAC domain-containing protein 19
3swm_D1e-431716919168NAC domain-containing protein 19
3swm_C1e-431716919168NAC domain-containing protein 19
3swm_B1e-431716919168NAC domain-containing protein 19
3swm_A1e-431716919168NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016454536.11e-166PREDICTED: NAC domain-containing protein 62-like
RefseqXP_016564177.11e-166PREDICTED: NAC domain-containing protein 62-like isoform X1
TrEMBLM0ZIK71e-165M0ZIK7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000014981e-164(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33632448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.24e-83TCV-interacting protein